Camk2n1 cDNA ORF clone, Mus musculus(house mouse)

Gene
Clones
gRNAs

Summary

Gene Symbol	Camk2n1
Entrez Gene ID	66259
Full Name	calcium/calmodulin-dependent protein kinase II inhibitor 1
Synonyms	1810006K23Rik,AI848599,AI891706
General protein information	Preferred Names calcium/calmodulin-dependent protein kinase II inhibitor 1 Names calcium/calmodulin-dependent protein kinase II inhibitor 1 CaMKII inhibitor protein alpha CaMKIIN-alpha CaMKIINalpha calcium/calmodulin-dependent protein kinase II inhibitor alpha mCaMKIINalpha
Gene Type	protein-coding
Organism	Mus musculus(house mouse)
Genome	Chromosome: 4 Map Location: 4\|4 D3

mRNA and Protein(s)

mRNA	Protein	Name
NM_025451.2	NP_079727.1	calcium/calmodulin-dependent protein kinase II inhibitor 1

Pathways from BioSystems

Homologies

Pan troglodytes (chimpanzee)	CAMK2N1	XP_001160942.1
Mus musculus (house mouse)	Camk2n1	NP_079727.1
Bos taurus (cattle)	CAMK2N1	NP_001107992.1
Rattus norvegicus (Norway rat)	Camk2n1	NP_775459.1
Homo sapiens (human)	CAMK2N1	NP_061054.2
	CAMK2N1	XP_001095951.1

Gene Ontology
Bibliography

Related articles in PubMed

Down-regulation of dorsal striatal ?CaMKII causes striatum-related cognitive and synaptic disorders.
Wang Q, Yin P, Yu B, Zhao Z, Richter-Levin G, Yu L, Cao X
Experimental neurology298(Pt A)112-121(2017 Dec)

In vivo and in vitro investigations of heterozygous nebulin knock-out mice disclose a mild skeletal muscle phenotype.
Gineste C, De Winter JM, Kohl C, Witt CC, Giannesini B, Brohm K, Le Fur Y, Gretz N, Vilmen C, Pecchi E, Jubeau M, Cozzone PJ, Stienen GJ, Granzier H, Labeit S, Ottenheijm CA, Bendahan D, Gondin J
Neuromuscular disorders : NMD23(4)357-69(2013 Apr)

Spatiotemporal regulation of multiple overlapping sense and novel natural antisense transcripts at the Nrgn and Camk2n1 gene loci during mouse cerebral corticogenesis.
Ling KH, Hewitt CA, Beissbarth T, Hyde L, Cheah PS, Smyth GK, Tan SS, Hahn CN, Thomas T, Thomas PQ, Scott HS
Cerebral cortex (New York, N.Y. : 1991)21(3)683-97(2011 Mar)

Endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest and apoptosis through down-regulation of the phosphatidylinositide 3-kinase/Akt/HDM2 pathway.
Ma S, Yang Y, Wang C, Hui N, Gu L, Zhong H, Cai Z, Wang Q, Zhang Q, Li N, Cao X
The Journal of biological chemistry284(37)24773-82(2009 Sep)

Molecular networks involved in mouse cerebral corticogenesis and spatio-temporal regulation of Sox4 and Sox11 novel antisense transcripts revealed by transcriptome profiling.
Ling KH, Hewitt CA, Beissbarth T, Hyde L, Banerjee K, Cheah PS, Cannon PZ, Hahn CN, Thomas PQ, Smyth GK, Tan SS, Thomas T, Scott HS
Genome biology10(10)R104(2009)

GeneRIFs: Gene References Into Functions What's a GeneRIF?

Camk2n1 down-regulation caused dorsal striatum-related cognitive disorders by inhibiting synaptic plasticity.
Title: Down-regulation of dorsal striatal ?CaMKII causes striatum-related cognitive and synaptic disorders.

We propose that the differential regulation of multiple sense and novel overlapping natural antisense transcripts at the Nrgn and Camk2n1 loci will increase the diversity of posttranscriptional regulation
Title: Spatiotemporal regulation of multiple overlapping sense and novel natural antisense transcripts at the Nrgn and Camk2n1 gene loci during mouse cerebral corticogenesis.

hCaMKIINbeta may play an important role in the regulation of tumor cell growth
Title: Endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest and apoptosis through down-regulation of the phosphatidylinositide 3-kinase/Akt/HDM2 pathway.

Camk2n1 was shown to be a 37 kDa protein localized in the post synaptic density (PSD) of mouse brain
Title: Characterization of mouse neuronal Ca2+/calmodulin kinase II inhibitor alpha.

The mouse Ca2+/calmodulin kinase II inhibitor alpha (CaMKIINalpha) gene encodes a 2.9kb brain-specific transcript whose expression is downregulated in mouse brain during Japanese encephalitis virus and rabies virus infection.
Title: Regulation of Ca2+/calmodulin kinase II inhibitor alpha (CaMKIINalpha) in virus-infected mouse brain.

The following Camk2n1 gene cDNA ORF clone sequences were retrieved from the NCBI Reference Sequence Database (RefSeq). These sequences represent the protein coding region of the Camk2n1 cDNA ORF which is encoded by the open reading frame (ORF) sequence. ORF sequences can be delivered in our standard vector, pcDNA3.1⁺/C-(K)DYK or the vector of your choice as an expression/transfection-ready ORF clone. Not the clone you want? Click here to find your clone.

***CloneID	Accession No.	Definition	**Vector	*Turnaround time	Price (USD)	Select
OMu21364	NM_025451.2 Latest version!	Mus musculus calcium/calmodulin-dependent protein kinase II inhibitor 1 (Camk2n1), mRNA.	pcDNA3.1-C-(k)DYK or customized vector	7-9	$69.30 $99.00

ORF Online Only Promotion

Next-day Shipping ORF Clones ( in default vector with tag)
1 Clone	30% OFF
2-4 Clone	40% OFF
5 or more Clone	50% OFF
All Other ORF Clones
30% OFF

*Business Day

** You may select a custom vector to replace pcDNA3.1+/C-(K)DYK after clone is added to cart.

** GenScript guarantees 100% sequence accuracy of all synthetic DNA constructs we deliver, but we do not guarantee protein expression in your experimental system. Protein expression is influenced by many factors that may vary between experiments or laboratories. In addition, please pay attention to the signal peptide, propeptide and transit peptide in target ORF, which may affect the choice of vector (N/C terminal tag vector).

***One clone ID might be correlated to multiple accession numbers, which share the same CDS sequence.

Reference Sequences (Refseq)

Camk2n1 ( NM_025451.2 ) cDNA ORF clone, Mus musculus(house mouse) -> NP_079727.1 Mus musculus calcium/calmodulin-dependent protein kinase II inhibitor 1 (Camk2n1), mRNA.

Price & Availability↑

CloneID	OMu21364
Clone ID Related Accession (Same CDS sequence)	NM_025451.2
Accession Version	NM_025451.2 Latest version!	Documents for ORF clone product in default vector
Sequence Information	ORF Nucleotide Sequence (Length: 237bp) Protein sequence SNP
Vector	pcDNA3.1-C-(k)DYK or customized vector	User Manual
Clone information	Clone Map	MSDS
Tag on pcDNA3.1⁺/C-(K)DYK	C terminal DYKDDDDK tags
ORF Insert Method	CloneEZ™ Seamless cloning technology
Insert Structure	linear
Update Date	2019-02-17
Organism	Mus musculus(house mouse)
Product	calcium/calmodulin-dependent protein kinase II inhibitor 1
Comment	Comment: VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL807249.8. On Jun 5, 2008 this sequence version replaced NM_025451.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: AY523601.1, SRR1660819.212366.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

ATGTCGGAGG TGCTGCCCTA CGGCGACGAG AAGCTGAGCC CCTACGGCGA CGGCGGCGAC 
GTGGGCCAGA TCTTCTCGTG CCGCCTGCAG GACACCAACA ACTTCTTCGG GGCTGGGCAG 
AGCAAGCGGC CTCCCAAGCT GGGCCAGATC GGCCGGAGCA AGCGCGTTGT TATTGAAGAT 
GATAGGATTG ATGACGTGCT GAAAACCATG ACCGACAAGG CACCCCCTGG TGTCTAA

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

RefSeq	NP_079727.1
CDS	39..275
Translation	MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV

Target ORF information:

RefSeq Version	NM_025451.2
Organism	Mus musculus(house mouse)
Definition	Mus musculus calcium/calmodulin-dependent protein kinase II inhibitor 1 (Camk2n1), mRNA.

Target ORF information:

Epitope	DYKDDDDK
Bacterial selection	AMP^R
Mammalian selection	Neo^R
Vector	pcDNA3.1⁺/C-(K)DYK

NM_025451.2

ORF Insert Sequence:

ATGTCGGAGG TGCTGCCCTA CGGCGACGAG AAGCTGAGCC CCTACGGCGA CGGCGGCGAC 
GTGGGCCAGA TCTTCTCGTG CCGCCTGCAG GACACCAACA ACTTCTTCGG GGCTGGGCAG 
AGCAAGCGGC CTCCCAAGCT GGGCCAGATC GGCCGGAGCA AGCGCGTTGT TATTGAAGAT 
GATAGGATTG ATGACGTGCT GAAAACCATG ACCGACAAGG CACCCCCTGG TGTCTAA

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

PubMed

Down-regulation of dorsal striatal ?CaMKII causes striatum-related cognitive and synaptic disorders.
Experimental neurology298(Pt A)112-121(2017 Dec)
Wang Q,Yin P,Yu B,Zhao Z,Richter-Levin G,Yu L,Cao X

In vivo and in vitro investigations of heterozygous nebulin knock-out mice disclose a mild skeletal muscle phenotype.
Neuromuscular disorders : NMD23(4)357-69(2013 Apr)
Gineste C,De Winter JM,Kohl C,Witt CC,Giannesini B,Brohm K,Le Fur Y,Gretz N,Vilmen C,Pecchi E,Jubeau M,Cozzone PJ,Stienen GJ,Granzier H,Labeit S,Ottenheijm CA,Bendahan D,Gondin J

Spatiotemporal regulation of multiple overlapping sense and novel natural antisense transcripts at the Nrgn and Camk2n1 gene loci during mouse cerebral corticogenesis.
Cerebral cortex (New York, N.Y. : 1991)21(3)683-97(2011 Mar)
Ling KH,Hewitt CA,Beissbarth T,Hyde L,Cheah PS,Smyth GK,Tan SS,Hahn CN,Thomas T,Thomas PQ,Scott HS

Endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest and apoptosis through down-regulation of the phosphatidylinositide 3-kinase/Akt/HDM2 pathway.
The Journal of biological chemistry284(37)24773-82(2009 Sep)
Ma S,Yang Y,Wang C,Hui N,Gu L,Zhong H,Cai Z,Wang Q,Zhang Q,Li N,Cao X

Molecular networks involved in mouse cerebral corticogenesis and spatio-temporal regulation of Sox4 and Sox11 novel antisense transcripts revealed by transcriptome profiling.
Genome biology10(10)R104(2009)
Ling KH,Hewitt CA,Beissbarth T,Hyde L,Banerjee K,Cheah PS,Cannon PZ,Hahn CN,Thomas PQ,Smyth GK,Tan SS,Thomas T,Scott HS