5-FAM-β-Amyloid (1-40)

This is a fluorescent 5-FAM-labeled β-Amyloid (1-40), Abs/Em=492/518 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Description	This is a fluorescent 5-FAM-labeled β-Amyloid (1-40), Abs/Em=492/518 nm. FAM is preferred over FITC because of its photo- and chemical stability.
Sequence	5-FAM-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu }{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp }{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met }{Val}{Gly}{Gly}{Val}{Val}
Sequence Shortening	5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight	4688.13 g/mol

Purity	>95%
Form	Lyophilized
Storage	Store at -20°C. Keep tightly closed. Store in a cool dry place.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.