Biotin-β-Amyloid (1-40)

Biotin-β-Amyloid (1-40)

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease. It is the major component of senile plaque amyloids, are physiological peptides present in the brain, cerebrospinal fluid (CSF) and plasma.This peptide is biotinylated at its N-terminu. Biotin is widely used throughout the biotechnology industry to conjugate proteins for biochemical assays. Biotin can be used for qualitative and quantitative detection, labelling or immobilisation.
RP30249
¥20,844.00

Ask us a question
Overview
Description β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease. It is the major component of senile plaque amyloids, are physiological peptides present in the brain, cerebrospinal fluid (CSF) and plasma.This botin peptide is biotinylated at its N-terminu. Biotin is widely used throughout the biotechnology industry to conjugate proteins for biochemical assays. Biotin can be used for qualitative and quantitative detection, labelling or immobilisation.
Sequence
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}
{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}
{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}
{Gly}{Gly}{Val}{Val}
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
N Terminal Biotin
Molecular Weight 4556.12

Properties
Purity >95%
Solubility Can be dissolved in 3% ammonia water.
Form Lyophilized
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.