5-FAM-β-Amyloid (1-42), human

5-FAM-β-Amyloid (1-42), human

5-FAM-Amyloid-β (1-42) peptide is a fluorescently labeled amyloid-β peptide. Amyloid-β (1-42) (Aβ42) peptide is the primary form of Aβ found in amyloid plaques in postmortem cerebral cortex from patients with Alzheimer's disease and its aggregation results in the formation of neurotoxic fibrils or globular oligomers. 5-FAM-Amyloid-β (1-42) is a labeled form of Aβ42 containing 5-carboxyfluorescein , which displays excitation/emission maxima of 492/518 nm, respectively.
RP30248
¥38,063.00

Ask us a question
Overview
Description 5-FAM-Amyloid-β (1-42) peptide is a fluorescently labeled amyloid-β peptide. Amyloid-β (1-42) (Aβ42) peptide is the primary form of Aβ found in amyloid plaques in postmortem cerebral cortex from patients with Alzheimer's disease and its aggregation results in the formation of neurotoxic fibrils or globular oligomers. 5-FAM-Amyloid-β (1-42) is a labeled form of Aβ42 containing 5-carboxyfluorescein , which displays excitation/emission maxima of 492/518 nm, respectively.
Sequence
5-FAM-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu
}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp
}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met
}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala}
Sequence Shortening 5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight 4872.36 g/mol

Properties
Purity >95%
Form Lyophilized
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.