| RP12738 | |
|
|
|
| ¥21,569.00 | |
|
|
|
|
|
|
| Ask us a question | |
| Synonyms | Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide |
| Description | GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone. |
| Sequence |
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER} {TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA} {TRP}{LEU}{VAL}{LYS}{GLY}{ARG}{GLY} |
| Sequence Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Molecular Formula | C151H228N40O47 |
| Molecular Weight | 3355.68 |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Form | Lyophilized |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
| Note | Potent Insulin secretagogue. |
