Catalog Peptides » All Catalog Peptides » β-Endorphin, human

β-Endorphin, human

Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
RP11344
¥12,869.00

Ask us a question
Overview
Description Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. β-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on μ receptors in brain and by μ and κ receptors in the spinal cord.
Cas No 61214-51-5
Sequence
{TYR}{GLY}{GLY}{PHE}{MET}{THR}{SER}{GLU}{LYS}{SER}{GLN}{THR}
{PRO}{LEU}{VAL}{THR}{LEU}{PHE}{LYS}{ASN}{ALA}{ILE}{ILE}{LYS}
{ASN}{ALA}{TYR}{LYS}{LYS}{GLY}{GLU}
Sequence Shortening YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Molecular Formula C158H251N39O46S1
Molecular Weight 3465.1

Properties
Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Form Lyophilized
Storage Store the peptide at -20°C