Catalog Peptides » Beta Amyloid Peptides » Amylin, human, amide

Amylin, human, amide

Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.
RP11278
¥25,013.00

Ask us a question
Overview
Synonyms Diabetes-Associated Peptide (DAP), amide, humanInsulinoma or islet amyloid polypeptide (IAPP)
Description Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.
Cas No 122384-88-7
Sequence
{LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{HIS}{SER}{SER}{ASN}{ASN}{PHE}{GLY}{ALA}{ILE}{LEU}{SER}{SER}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
Sequence Shortening KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
Molecular Formula C165H261N51O55S2
C Terminal NH2
Disulfide Bridge Cys2-Cys7
Molecular Weight 3903.28

Properties
Purity > 95%
Solubility Can be dissolved in DMSO or DMF first and then dilute with water
Form Lyophilized
Storage Store at -20°C. Keep container tightly closed. Store in a cool dry place.