Catalog Peptides » Gastric Inhibitory Peptide (GIP), human

Gastric Inhibitory Peptide (GIP), human

Our peptides are intended for scientific research and drug development, not for human consumption.

GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insulin secretion. GIP may also play a role in adipocyte biology.
RP10795
¥16,313.00

Ask us a question
Overview
Description GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits potent incretin activity in rodent and human subjects. The primary action of GIP is the stimulation of glucose-dependent insulin secretion. GIP may also play a role in adipocyte biology.
Cas No 100040-31-1
Sequence
{TYR}{ALA}{GLU}{GLY}{THR}{PHE}{ILE}{SER}{ASP}{TYR}{SER}{ILE}
{ALA}{MET}{ASP}{LYS}{ILE}{HIS}{GLN}{GLN}{ASP}{PHE}{VAL}{ASN}
{TRP}{LEU}{LEU}{ALA}{GLN}{LYS}{GLY}{LYS}{LYS}{ASN}{ASP}{TRP}
{LYS}{HIS}{ASN}{ILE}{THR}{GLN}
Sequence Shortening YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Molecular Formula C226H338N60O66S1
Molecular Weight 4983.6

Properties
Purity > 95%
Solubility Soluble in Ultrapure water under 1mg/ml
Form Lyophilized
Storage Store the peptide at -20°C.