Catalog Peptides » All Catalog Peptides » Glucagon-Like Peptide (GLP) II, human

Glucagon-Like Peptide (GLP) II, human

Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.
RP10769
¥16,313.00

Ask us a question
Overview
Synonyms Glucagon-Like PeptideII; Glucagon-Like Peptide 2; Glucagon-Like Peptide2; GLP II; GLPII; GLP 2; GLP2
Description Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.
Cas No 223460-79-5
Sequence
{HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}
{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}{ASP}{PHE}{ILE}{ASN}
{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}
Sequence Shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular Formula C165H254N44O55S1
Molecular Weight 3766.2

Properties
Purity > 95%
Solubility Soluble in dimethyl sulfoxide(Analytical grade) under 1mg/ml
Form Lyophilized
Storage Store the peptide at -20°C. Keep container tightly closed.