Catalog Peptides » Beta Amyloid Peptides » β-Amyloid (1-40)

β-Amyloid (1-40)

Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
RP10004
¥20,663.00

Ask us a question
Overview
Synonyms amyloid peptide; amyloid beta protein; beta amyloid plaques
Description Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
Cas No 131438-79-4
Sequence
{ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL}
{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}
{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}
{GLY}{GLY}{VAL}{VAL}
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Formula C194H295N53O58S1
Molecular Weight 4329.82

Properties
Purity > 95%
Solubility Insoluble in water, may be dissolved in any buffer of pH >9.
Form Lyophilized
Storage Store at -20°C
Note In culture, beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons, it causes dendritic and axonal retraction followed by neuronal death.