Atp5e cDNA ORF clone, Mus musculus(house mouse)

Gene
Clones
gRNAs

Summary

Gene Symbol	Atp5e
Entrez Gene ID	67126
Full Name	ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Synonyms	2410043G19Rik,ATPE,AV000645
General protein information	Preferred Names ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit Names ATP synthase subunit epsilon, mitochondrial ATP synthase epsilon chain, mitochondrial ATPase subunit epsilon mitochondrial ATP synthase epsilon subunit
Gene Type	protein-coding
Organism	Mus musculus(house mouse)
Genome	Chromosome: 2 Map Location: 2\|2 H4

mRNA and Protein(s)

mRNA	Protein	Name
NM_025983.3	NP_080259.1	ATP synthase subunit epsilon, mitochondrial

Pathways from BioSystems
Gene Ontology
Bibliography

Related articles in PubMed

High-throughput discovery of novel developmental phenotypes.
Dickinson ME, Flenniken AM, Ji X, Teboul L, Wong MD, White JK, Meehan TF, Weninger WJ, Westerberg H, Adissu H, Baker CN, Bower L, Brown JM, Caddle LB, Chiani F, Clary D, Cleak J, Daly MJ, Denegre JM, Doe B, Dolan ME, Edie SM, Fuchs H, Gailus-Durner V, Galli A, Gambadoro A, Gallegos J, Guo S, Horner NR, Hsu CW, Johnson SJ, Kalaga S, Keith LC, Lanoue L, Lawson TN, Lek M, Mark M, Marschall S, Mason J, McElwee ML, Newbigging S, Nutter LM, Peterson KA, Ramirez-Solis R, Rowland DJ, Ryder E, Samocha KE, Seavitt JR, Selloum M, Szoke-Kovacs Z, Tamura M, Trainor AG, Tudose I, Wakana S, Warren J, Wendling O, West DB, Wong L, Yoshiki A, , , , , , , , , MacArthur DG, Tocchini-Valentini GP, Gao X, Flicek P, Bradley A, Skarnes WC, Justice MJ, Parkinson HE, Moore M, Wells S, Braun RE, Svenson KL, de Angelis MH, Herault Y, Mohun T, Mallon AM, Henkelman RM, Brown SD, Adams DJ, Lloyd KC, McKerlie C, Beaudet AL, Bu?an M, Murray SA
Nature537(7621)508-514(2016 09)

Evaluation of TRAP-sequencing technology with a versatile conditional mouse model.
Hupe M, Li MX, Gertow Gillner K, Adams RH, Stenman JM
Nucleic acids research42(2)e14(2014 Jan)

Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.
Mootha VK, Bunkenborg J, Olsen JV, Hjerrild M, Wisniewski JR, Stahl E, Bolouri MS, Ray HN, Sihag S, Kamal M, Patterson N, Lander ES, Mann M
Cell115(5)629-40(2003 Nov)

Proteomic analysis of the mouse liver mitochondrial inner membrane.
Da Cruz S, Xenarios I, Langridge J, Vilbois F, Parone PA, Martinou JC
The Journal of biological chemistry278(42)41566-71(2003 Oct)

Cloning, characterization and mapping of the human ATP5E gene, identification of pseudogene ATP5EP1, and definition of the ATP5E motif.
Tu Q, Yu L, Zhang P, Zhang M, Zhang H, Jiang J, Chen C, Zhao S
The Biochemical journal347 Pt 117-21(2000 Apr)

GeneRIFs: Gene References Into Functions What's a GeneRIF?

The following Atp5e gene cDNA ORF clone sequences were retrieved from the NCBI Reference Sequence Database (RefSeq). These sequences represent the protein coding region of the Atp5e cDNA ORF which is encoded by the open reading frame (ORF) sequence. ORF sequences can be delivered in our standard vector, pcDNA3.1⁺/C-(K)DYK or the vector of your choice as an expression/transfection-ready ORF clone. Not the clone you want? Click here to find your clone.

***CloneID	Accession No.	Definition	**Vector	*Turnaround time	Price (USD)	Select
OMu14794	NM_025983.3 Latest version!	Mus musculus ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e), mRNA.	pcDNA3.1-C-(k)DYK or customized vector	5-7	$69.30 $99.00

ORF Online Only Promotion

Next-day Shipping ORF Clones ( in default vector with tag)
1 Clone	30% OFF
2-4 Clone	40% OFF
5 or more Clone	50% OFF
All Other ORF Clones
30% OFF

*Business Day

** You may select a custom vector to replace pcDNA3.1+/C-(K)DYK after clone is added to cart.

** GenScript guarantees 100% sequence accuracy of all synthetic DNA constructs we deliver, but we do not guarantee protein expression in your experimental system. Protein expression is influenced by many factors that may vary between experiments or laboratories. In addition, please pay attention to the signal peptide, propeptide and transit peptide in target ORF, which may affect the choice of vector (N/C terminal tag vector).

***One clone ID might be correlated to multiple accession numbers, which share the same CDS sequence.

Reference Sequences (Refseq)

Atp5e ( NM_025983.3 ) cDNA ORF clone, Mus musculus(house mouse) -> NP_080259.1 Mus musculus ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e), mRNA.

Price & Availability↑

CloneID	OMu14794
Clone ID Related Accession (Same CDS sequence)	NM_025983.3
Accession Version	NM_025983.3 Latest version!	Documents for ORF clone product in default vector
Sequence Information	ORF Nucleotide Sequence (Length: 159bp) Protein sequence SNP
Vector	pcDNA3.1-C-(k)DYK or customized vector	User Manual
Clone information	Clone Map	MSDS
Tag on pcDNA3.1⁺/C-(K)DYK	C terminal DYKDDDDK tags
ORF Insert Method	CloneEZ™ Seamless cloning technology
Insert Structure	linear
Update Date	2019-10-19
Organism	Mus musculus(house mouse)
Product	ATP synthase subunit epsilon, mitochondrial
Comment	Comment: VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CJ322223.1 and W78532.1. On Sep 8, 2006 this sequence version replaced NM_025983.2. ##Evidence-Data-START## Transcript exon combination :: BU843356.1, BU963076.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849375, SAMN00849380 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: reported by MitoCarta ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end.

1
61
121

ATGGTGGCGT ACTGGCGACA GGCTGGACTC AGCTACATCC GGTTTTCCCA GATCTGTGCA 
AAAGCAGTGA GGGATGCCCT GAAGACCGAG TTCAAAGCGA ACGCTGAGAA GACTTCGGGC 
AGCAGCATAA AAATTGTGAA AGTCTCGAAG AAGGAGTAG

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

RefSeq	NP_080259.1
CDS	106..264
Translation	MVAYWRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIKIVKVSKKE

Target ORF information:

RefSeq Version	NM_025983.3
Organism	Mus musculus(house mouse)
Definition	Mus musculus ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (Atp5e), mRNA.

Target ORF information:

Epitope	DYKDDDDK
Bacterial selection	AMP^R
Mammalian selection	Neo^R
Vector	pcDNA3.1⁺/C-(K)DYK

NM_025983.3

ORF Insert Sequence:

1
61
121

ATGGTGGCGT ACTGGCGACA GGCTGGACTC AGCTACATCC GGTTTTCCCA GATCTGTGCA 
AAAGCAGTGA GGGATGCCCT GAAGACCGAG TTCAAAGCGA ACGCTGAGAA GACTTCGGGC 
AGCAGCATAA AAATTGTGAA AGTCTCGAAG AAGGAGTAG

The stop codons will be deleted if pcDNA3.1⁺/C-(K)DYK vector is selected.

PubMed

High-throughput discovery of novel developmental phenotypes.
Nature537(7621)508-514(2016 09)
Dickinson ME,Flenniken AM,Ji X,Teboul L,Wong MD,White JK,Meehan TF,Weninger WJ,Westerberg H,Adissu H,Baker CN,Bower L,Brown JM,Caddle LB,Chiani F,Clary D,Cleak J,Daly MJ,Denegre JM,Doe B,Dolan ME,Edie SM,Fuchs H,Gailus-Durner V,Galli A,Gambadoro A,Gallegos J,Guo S,Horner NR,Hsu CW,Johnson SJ,Kalaga S,Keith LC,Lanoue L,Lawson TN,Lek M,Mark M,Marschall S,Mason J,McElwee ML,Newbigging S,Nutter LM,Peterson KA,Ramirez-Solis R,Rowland DJ,Ryder E,Samocha KE,Seavitt JR,Selloum M,Szoke-Kovacs Z,Tamura M,Trainor AG,Tudose I,Wakana S,Warren J,Wendling O,West DB,Wong L,Yoshiki A,,,,,,,,,MacArthur DG,Tocchini-Valentini GP,Gao X,Flicek P,Bradley A,Skarnes WC,Justice MJ,Parkinson HE,Moore M,Wells S,Braun RE,Svenson KL,de Angelis MH,Herault Y,Mohun T,Mallon AM,Henkelman RM,Brown SD,Adams DJ,Lloyd KC,McKerlie C,Beaudet AL,Bu?an M,Murray SA

Evaluation of TRAP-sequencing technology with a versatile conditional mouse model.
Nucleic acids research42(2)e14(2014 Jan)
Hupe M,Li MX,Gertow Gillner K,Adams RH,Stenman JM

Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.
Cell115(5)629-40(2003 Nov)
Mootha VK,Bunkenborg J,Olsen JV,Hjerrild M,Wisniewski JR,Stahl E,Bolouri MS,Ray HN,Sihag S,Kamal M,Patterson N,Lander ES,Mann M

Proteomic analysis of the mouse liver mitochondrial inner membrane.
The Journal of biological chemistry278(42)41566-71(2003 Oct)
Da Cruz S,Xenarios I,Langridge J,Vilbois F,Parone PA,Martinou JC

Cloning, characterization and mapping of the human ATP5E gene, identification of pseudogene ATP5EP1, and definition of the ATP5E motif.
The Biochemical journal347 Pt 117-21(2000 Apr)
Tu Q,Yu L,Zhang P,Zhang M,Zhang H,Jiang J,Chen C,Zhao S